Iga Monoclonal Multiple Myeloma

Leukemia - Multiple Myeloma Exosome

P141-MM - Ask for price

Iga Monoclonal Laboratories manufactures the iga monoclonal multiple myeloma reagents distributed by Genprice. The Iga Monoclonal Multiple Myeloma reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal Group: Multiple Myeloma

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Multiple Myeloma information

Human Myeloma IgM Protein

abx061006-2mg 2 mg
EUR 644.4

Multiple Line Reader

LFRB-001 Each
EUR 4699.99
Description: Multiple Line Reader is a portable universal lateral-flow reader that is based on colour change method.

Multiple organ (10 types)

BE01015 each
EUR 168
Description: Multiple organ (10 types), normal fetus tissue array, 13 cases/50 cores

Myeloma Overexpressed (MYEOV) Antibody

abx235466-100ug 100 ug
EUR 661.2

Myeloma Overexpressed (MYEOV) Antibody

20-abx113918
  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

Monoclonal Mouse Anti-Human IgA

C010208-10mg 10mg
EUR 1336.8

Monoclonal Mouse Anti-Human IgA

C010208-1mg 1mg
EUR 322.8

Mouse Anti Dog Iga Monoclonal Antibody

DMABT-51916MD 2 ml
EUR 889.2

Mouse Anti Pig Iga Monoclonal Antibody

DMABT-51917MP 0.25 mg
EUR 920.4

Mouse Anti Cat Iga Monoclonal Antibody

DMABT-51971MC 0.25 mg
EUR 920.4

Mouse Anti Cat Iga Monoclonal Antibody

DMABT-51973MC 2 ml
EUR 889.2

Mouse Anti Pig Iga Monoclonal Antibody

DMABT-52031MP 2 ml
EUR 889.2

Human IgG1 Fab fragment (myeloma)

20007-G1-Fab 100 ug
EUR 270

Human Myeloma IgE lambda Protein

abx061003-1mg 1 mg
EUR 4869.6

Human Myeloma IgG1 kappa Protein

abx061004-1mg 1 mg
EUR 460.8

Mouse Anti Human Iga Monoclonal Antibody

CABT-48820MH 1 mg
EUR 889.2

Mouse Anti Horse Iga Monoclonal Antibody

DMABT-51963MH 2 ml
EUR 889.2
Copyright © 2023 Interleukin 12
Theme by Pro